Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPFFR2 Peptide - C-terminal region

NPFFR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR74, HLWAR77, NPFF2, NPGPR

UniProt

A0PJM9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPFFR2 Rabbit Polyclonal Antibody (orb584380) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444264

Preservative

Lyophilized powder

AA Sequence

KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Amyloid Precursor Protein (Ser730) Rabbit Polyclonal Antibody (BF594)
orb1598989 100 µL

Phospho-Amyloid Precursor Protein (Ser730) Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Anti-MCK10/NEP/DDR1 Antibody Picoband® (Biotine Conjugate)
A00905-Biotin 100 µg/Vial

Anti-MCK10/NEP/DDR1 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Mouse CD200R1L MAb (Clone 2692A)
MAB10198-100 100 µg

Mouse CD200R1L MAb (Clone 2692A)

Sign In for Pricing
View Details
Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein
RP01825-01 10 μg

Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein

Sign In for Pricing
View Details
Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein
RP01825-02 20 μg

Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein

Sign In for Pricing
View Details
Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein
RP01825-03 50 μg

Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein

Sign In for Pricing
View Details