Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPS Peptide - N-terminal region

NPS Peptide - N-terminal region

Product Specifications

UniProt

P0C0P6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPS Rabbit Polyclonal Antibody (orb326456) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025184

Preservative

Lyophilized powder

AA Sequence

LILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosine Hydroxylase (TH) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D8]
TA506553BM 100 µL

Tyrosine Hydroxylase (TH) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D8]

Sign In for Pricing
View Details
(5S,5’S)-Dihydroxy Lysinonorleucine-d4
TRC-D452902-5MG 5 mg

(5S,5’S)-Dihydroxy Lysinonorleucine-d4

Sign In for Pricing
View Details
NISCH (NM_007184) Human Recombinant Protein
TP306026M 100 µg

NISCH (NM_007184) Human Recombinant Protein

Sign In for Pricing
View Details
Human HAVCR2 Antibody Pair Set
E-KAB-0437 50 µL & 100 µg

Human HAVCR2 Antibody Pair Set

Sign In for Pricing
View Details
Zfp68 Mouse Gene Knockout Kit (CRISPR)
KN519937 1 Kit

Zfp68 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3a,12a-Dihydroxy-5b-chol-9(11)-enic Acid
TRC-D452808-25MG 25 mg

3a,12a-Dihydroxy-5b-chol-9(11)-enic Acid

Sign In for Pricing
View Details