Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPS Peptide - N-terminal region

NPS Peptide - N-terminal region

Product Specifications

UniProt

P0C0P6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPS Rabbit Polyclonal Antibody (orb326456) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025184

Preservative

Lyophilized powder

AA Sequence

LILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (TFRC) (C-term) Rabbit Polyclonal Antibody
AP23306PU-N 100 µg

CD71 (TFRC) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF594 conjugate, 0.1mg/mL
BNC942561-500 1x 500 µL

NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561500 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Serpina11 Mouse Gene Knockout Kit (CRISPR)
KN515554 1 Kit

Serpina11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vmn1r70 Mouse Gene Knockout Kit (CRISPR)
KN519086 1 Kit

Vmn1r70 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Estriol-d1
TRC-E888963-1MG 1 mg

Estriol-d1

Sign In for Pricing
View Details