Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTX2 Peptide - N-terminal region

NPTX2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NARP, NP-II, NP2

UniProt

P47972

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPTX2 Rabbit Polyclonal Antibody (orb583128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002514

Preservative

Lyophilized powder

AA Sequence

VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY1A2 (NM_000855) Human Over-expression Lysate
LC424486 20 µg

GUCY1A2 (NM_000855) Human Over-expression Lysate

Sign In for Pricing
View Details
6X His tag Recombinant Rabbit monoclonal Antibody
HA720221F 100 µL

6X His tag Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
BMP2 Recombinant Rabbit Monoclonal Antibody [JE10-29]
HA722693 100 µL

BMP2 Recombinant Rabbit Monoclonal Antibody [JE10-29]

Sign In for Pricing
View Details
Recombinant Human COL1α2 protein (His tag)
PDEH100834-01 20 µg

Recombinant Human COL1α2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human COL1α2 protein (His tag)
PDEH100834-02 100 µg

Recombinant Human COL1α2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human COL1α2 protein (His tag)
PDEH100834-03 500 µg

Recombinant Human COL1α2 protein (His tag)

Sign In for Pricing
View Details