Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTX2 Peptide - N-terminal region

NPTX2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NARP, NP-II, NP2

UniProt

P47972

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPTX2 Rabbit Polyclonal Antibody (orb583128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002514

Preservative

Lyophilized powder

AA Sequence

VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac Salsolinol Hydrochloride
TRC-S100000-5G 5 g

rac Salsolinol Hydrochloride

Sign In for Pricing
View Details
C1QL4 (N-term) Rabbit Polyclonal Antibody
AP50565PU-N 400 µL

C1QL4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CTNNA1 Antibody
RC-4394-01 50 μL

Recombinant CTNNA1 Antibody

Sign In for Pricing
View Details
Recombinant CTNNA1 Antibody
RC-4394-02 100 µL

Recombinant CTNNA1 Antibody

Sign In for Pricing
View Details
Recombinant CTNNA1 Antibody
RC-4394-03 1 mL

Recombinant CTNNA1 Antibody

Sign In for Pricing
View Details
ZNF545 (ZFP82) Mouse Monoclonal Antibody [Clone ID: OTI5D8]
CF812054 100 µg

ZNF545 (ZFP82) Mouse Monoclonal Antibody [Clone ID: OTI5D8]

Sign In for Pricing
View Details