Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr1h3 Peptide - C-terminal region

Nr1h3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU018371, LXR, RLD1, Unr1

UniProt

Q9Z0Y9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nr1h3 Rabbit Polyclonal Antibody (orb574327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038867

Preservative

Lyophilized powder

AA Sequence

LLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLMFPRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®568 Monoclonal Mouse Anti-Biotin IgG, 2 mg/mL
#20502-250uL 1x 250 µL

CF®568 Monoclonal Mouse Anti-Biotin IgG, 2 mg/mL

Sign In for Pricing
View Details
Trisodium UDP-glucuronic Acid
TRC-T886285-10MG 10 mg

Trisodium UDP-glucuronic Acid

Sign In for Pricing
View Details
Racked ultra low retention tip 96x10 BPIC-427
BPIC-427 1 Unit

Racked ultra low retention tip 96x10 BPIC-427

Sign In for Pricing
View Details
Trit1 Mouse Gene Knockout Kit (CRISPR)
KN518255 1 Kit

Trit1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APC Anti-Human CD21 Antibody[BU32]
E-AB-F1046E-01 20 Tests

APC Anti-Human CD21 Antibody[BU32]

Sign In for Pricing
View Details
APC Anti-Human CD21 Antibody[BU32]
E-AB-F1046E-02 100 Tests

APC Anti-Human CD21 Antibody[BU32]

Sign In for Pricing
View Details