Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr1h3 Peptide - C-terminal region

Nr1h3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU018371, LXR, RLD1, Unr1

UniProt

Q9Z0Y9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nr1h3 Rabbit Polyclonal Antibody (orb574327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038867

Preservative

Lyophilized powder

AA Sequence

LLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLMFPRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH5A1 Polyclonal Antibody
E-AB-16147-01 20 µL

ALDH5A1 Polyclonal Antibody

Sign In for Pricing
View Details
ALDH5A1 Polyclonal Antibody
E-AB-16147-02 60 µL

ALDH5A1 Polyclonal Antibody

Sign In for Pricing
View Details
ALDH5A1 Polyclonal Antibody
E-AB-16147-03 120 µL

ALDH5A1 Polyclonal Antibody

Sign In for Pricing
View Details
ALDH5A1 Polyclonal Antibody
E-AB-16147-04 200 µL

ALDH5A1 Polyclonal Antibody

Sign In for Pricing
View Details
HA tag, AlpHcAbs® Mouse IgG1
HA710213 100 µg

HA tag, AlpHcAbs® Mouse IgG1

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF680R conjugate, 0.1mg/mL
BNC812748-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details