Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr5a2 Peptide - C-terminal region

Nr5a2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU020803, D1Ertd308e, Ftf, LRH-1

UniProt

P45448

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nr5a2 Rabbit Polyclonal Antibody (orb576300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_109601

Preservative

Lyophilized powder

AA Sequence

LDYTVCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-CREB1 (aa96-109) Antibody
MBS423196-01 0.1 mg

Goat anti-CREB1 (aa96-109) Antibody

Sign In for Pricing
View Details
Goat anti-CREB1 (aa96-109) Antibody
MBS423196-02 5x 0.1 mg

Goat anti-CREB1 (aa96-109) Antibody

Sign In for Pricing
View Details
MPZL2 AAV Vector (Human) (CMV)
30381101 1 µg

MPZL2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Alcohol Dehydrogenase (ADH) Assay Kit
E47S337 100 Tests - 96 Samples

Alcohol Dehydrogenase (ADH) Assay Kit

Sign In for Pricing
View Details
RAD18 Antibody (Rabbit Polyclonal)
MBS8509235-01 0.2 mL

RAD18 Antibody (Rabbit Polyclonal)

Sign In for Pricing
View Details
RAD18 Antibody (Rabbit Polyclonal)
MBS8509235-02 0.1 mL (AF405L)

RAD18 Antibody (Rabbit Polyclonal)

Sign In for Pricing
View Details