Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr5a2 Peptide - middle region

Nr5a2 Peptide - middle region

Product Specifications

Product Name Alternative

AU020803, D1Ertd308e, Ftf, LRH-1

UniProt

P45448

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR5A2 Rabbit Polyclonal Antibody (orb576301) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_109601

Preservative

Lyophilized powder

AA Sequence

PQLVVNTPLQGQITSTQVTNQHLLRESNVISAQGPKPMRSSQLLPASGRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGT2B17 Peptide - middle region
MBS3245242-01 0.1 mg

UGT2B17 Peptide - middle region

Sign In for Pricing
View Details
UGT2B17 Peptide - middle region
MBS3245242-02 5x 0.1 mg

UGT2B17 Peptide - middle region

Sign In for Pricing
View Details
CREB (Phospho-Ser133) Antibody
MBS9400815-01 0.05 mL

CREB (Phospho-Ser133) Antibody

Sign In for Pricing
View Details
CREB (Phospho-Ser133) Antibody
MBS9400815-02 0.1 mL

CREB (Phospho-Ser133) Antibody

Sign In for Pricing
View Details
CREB (Phospho-Ser133) Antibody
MBS9400815-03 5x 0.1 mL

CREB (Phospho-Ser133) Antibody

Sign In for Pricing
View Details
Goat anti-D-amino-acid oxidase (mouse) Antibody
MBS422704-01 0.1 mg

Goat anti-D-amino-acid oxidase (mouse) Antibody

Sign In for Pricing
View Details