Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr5a2 Peptide - middle region

Nr5a2 Peptide - middle region

Product Specifications

Product Name Alternative

AU020803, D1Ertd308e, Ftf, LRH-1

UniProt

P45448

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR5A2 Rabbit Polyclonal Antibody (orb576301) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_109601

Preservative

Lyophilized powder

AA Sequence

PQLVVNTPLQGQITSTQVTNQHLLRESNVISAQGPKPMRSSQLLPASGRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX18P3 Protein Vector (Human) (pPM-C-HA)
45049021 500 ng

SNX18P3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
RPB5 Antibody
orb863041 2 mg

RPB5 Antibody

Sign In for Pricing
View Details
Gpha2 ORF Vector (Rat) (pORF)
ORF067744 1.0 µg DNA

Gpha2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Phenoxyacetyl chloride
sc-253259 10 g

Phenoxyacetyl chloride

Sign In for Pricing
View Details
ATP1B3P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0145305 3x 1.0 µg

ATP1B3P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
DUSP3 Recombinant Protein (Rat)
RP198830 100 µg

DUSP3 Recombinant Protein (Rat)

Sign In for Pricing
View Details