Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nrbf2 Peptide - N-terminal region

Nrbf2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NRBF-2

UniProt

Q8VCQ3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nrbf2 Rabbit Polyclonal Antibody (orb578555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001031370

Preservative

Lyophilized powder

AA Sequence

EGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBL Rabbit Polyclonal Antibody
AP06505PU-N 100 µg

CBL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Arpp21 Mouse Gene Knockout Kit (CRISPR)
KN501614 1 Kit

Arpp21 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS501069 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Recombinant Human SEMA4A/Semaphorin B Protein (Fc Tag)
PKSH031008 100 µg

Recombinant Human SEMA4A/Semaphorin B Protein (Fc Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS809240 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
IL31RA Antibody (Biotin)
KB-15772-01 50 μL

IL31RA Antibody (Biotin)

Sign In for Pricing
View Details