Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSL1 Peptide - C-terminal region

NSL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1orf48, DC8, DKFZp566O1646, MIS14

UniProt

Q96IY1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NSL1 Rabbit Polyclonal Antibody (orb585253) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056286

Preservative

Lyophilized powder

AA Sequence

PALIEQGEGFSQVLRMQPVIHLQRIHQEVFSSCHRKPDAKPENFITQIET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Parvovirus Ns1 Positive Control
MBS412140-01 1 mL

Rat Parvovirus Ns1 Positive Control

Sign In for Pricing
View Details
Rat Parvovirus Ns1 Positive Control
MBS412140-02 5x 1 mL

Rat Parvovirus Ns1 Positive Control

Sign In for Pricing
View Details
Lentiviral human TSSK6 sgRNA gene knockout kit - Lentiviral human TSSK6 sgRNA gene knockout kit (plasmid)
GTR15362207 1 Vial

Lentiviral human TSSK6 sgRNA gene knockout kit - Lentiviral human TSSK6 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PLXNB2 Adenovirus (Mouse)
37049054 1.0 mL

PLXNB2 Adenovirus (Mouse)

Sign In for Pricing
View Details
CTNNAL1 (Catenin (Cadherin-Associated Protein), alpha-like 1, CLLP, FLJ08121, alpha-CATU)
245060 100 µg

CTNNAL1 (Catenin (Cadherin-Associated Protein), alpha-like 1, CLLP, FLJ08121, alpha-CATU)

Sign In for Pricing
View Details
LYRM1 (NM_001128302) Human Tagged ORF Clone
RG225067 10 µg

LYRM1 (NM_001128302) Human Tagged ORF Clone

Sign In for Pricing
View Details