Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSMCE1 Peptide - middle region

NSMCE1 Peptide - middle region

Product Specifications

Product Name Alternative

NSE1

UniProt

Q8WV22

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NSMCE1 Rabbit Polyclonal Antibody (orb578818) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659547

Preservative

Lyophilized powder

AA Sequence

KKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS501733 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
EGTA
TRC-E440150-100G 100 g

EGTA

Sign In for Pricing
View Details
Recombinant HCoV-HKU1 (Isolate N1) S1 Protein (His Tag)
PKSV030109 100 µg

Recombinant HCoV-HKU1 (Isolate N1) S1 Protein (His Tag)

Sign In for Pricing
View Details
Aquaporin 6 (AQP6) Human Gene Knockout Kit (CRISPR)
KN415710 1 Kit

Aquaporin 6 (AQP6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tubb2a Mouse Gene Knockout Kit (CRISPR)
KN518467 1 Kit

Tubb2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tal1 (BTL73), CF640R conjugate, 0.1mg/mL
BNC402852-100 1x 100 µL

Tal1 (BTL73), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details