Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSMCE1 Peptide - middle region

NSMCE1 Peptide - middle region

Product Specifications

Product Name Alternative

NSE1

UniProt

Q8WV22

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NSMCE1 Rabbit Polyclonal Antibody (orb578818) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659547

Preservative

Lyophilized powder

AA Sequence

KKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB27A Goat Polyclonal Antibody
AB7223-500 1.5 mg

RAB27A Goat Polyclonal Antibody

Sign In for Pricing
View Details
Decorin (DCN) (NM_001920) Human Over-expression Lysate
LC419655 20 µg

Decorin (DCN) (NM_001920) Human Over-expression Lysate

Sign In for Pricing
View Details
CYP21A2 (NM_000500) Human Recombinant Protein
TP316416M 100 µg

CYP21A2 (NM_000500) Human Recombinant Protein

Sign In for Pricing
View Details
PE Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181UD-01 25 µg

PE Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
PE Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181UD-02 100 µg

PE Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: bilateral
CB500535 1 Block

Frozen Tissue Blocks, Ovary: bilateral

Sign In for Pricing
View Details