Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5M Peptide - N-terminal region

NT5M Peptide - N-terminal region

Product Specifications

Product Name Alternative

DNT-2, dNT2, mdN

UniProt

Q9NPB1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NT5M Rabbit Polyclonal Antibody (orb583539) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064586

Preservative

Lyophilized powder

AA Sequence

ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBAP1 Human Pre-designed siRNA Set A
HY-RS15328 1 Set

UBAP1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human TJP1 Pre-designed siRNA Set A
SI016677A 1 Each

Human TJP1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Pseudomonas Aeruginosa Serotype 8 Antibody
GWB-Q01248 0.2 mg

Pseudomonas Aeruginosa Serotype 8 Antibody

Sign In for Pricing
View Details
MuL1 (NM_001106695) Rat Untagged Clone
RN204775 10 µg

MuL1 (NM_001106695) Rat Untagged Clone

Sign In for Pricing
View Details
Alkylphenols antibody
70-1067 50 μL

Alkylphenols antibody

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (5, 6 dihydroxyindole 2 carboxylic acid oxidase, 6-dihydroxyindole-2-carboxylic acid oxidase, Associated with iris pigmentation, CAS2, Catalase B, CATB, DHICA oxidase, GlycoProtein75, GP75, Melanoma antigen gp75, Tyrosinase-re
MBS6124562-01 0.1 mL

Tyrosinase-Related Protein-1 (5, 6 dihydroxyindole 2 carboxylic acid oxidase, 6-dihydroxyindole-2-carboxylic acid oxidase, Associated with iris pigmentation, CAS2, Catalase B, CATB, DHICA oxidase, GlycoProtein75, GP75, Melanoma antigen gp75, Tyrosinase-re

Sign In for Pricing
View Details