Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5M Peptide - N-terminal region

NT5M Peptide - N-terminal region

Product Specifications

Product Name Alternative

DNT-2, dNT2, mdN

UniProt

Q9NPB1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NT5M Rabbit Polyclonal Antibody (orb583539) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064586

Preservative

Lyophilized powder

AA Sequence

ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coptisine chloride
M18873-01 1 g

Coptisine chloride

Sign In for Pricing
View Details
Coptisine chloride
M18873-02 5 mg

Coptisine chloride

Sign In for Pricing
View Details
Coptisine chloride
M18873-03 10 mg

Coptisine chloride

Sign In for Pricing
View Details
Coptisine chloride
M18873-04 25 mg

Coptisine chloride

Sign In for Pricing
View Details
Coptisine chloride
M18873-05 50 mg

Coptisine chloride

Sign In for Pricing
View Details
Coptisine chloride
M18873-06 100 mg

Coptisine chloride

Sign In for Pricing
View Details