Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTNG2 Peptide - middle region

NTNG2 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0625, KIAA1857, LHLL9381, Lmnt2, MGC21884, NTNG1, bA479K20.1

UniProt

Q96CW9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NTNG2 Rabbit Polyclonal Antibody (orb331096) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115925

Preservative

Lyophilized powder

AA Sequence

YSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Host cell factor C2 Antibody [DyLight 650]
NBP2-99120C 0.1 mL

Rabbit Polyclonal Host cell factor C2 Antibody [DyLight 650]

Sign In for Pricing
View Details
PPIB Adenovirus (Mouse)
37356054 1.0 mL

PPIB Adenovirus (Mouse)

Sign In for Pricing
View Details
PYROXD2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
38257151 3x 1.0 µg DNA

PYROXD2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Stk4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3857203 1.0 µg DNA

Stk4 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal CYTB Antibody
NBP2-57841 100 µL

Rabbit Polyclonal CYTB Antibody

Sign In for Pricing
View Details
DiagNano™ GSH conjugated Gold Nanorods, diameter 25 nm, absorption max 700 nm
RGS-25-700 1 mL

DiagNano™ GSH conjugated Gold Nanorods, diameter 25 nm, absorption max 700 nm

Sign In for Pricing
View Details