Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUBP1 Peptide - middle region

NUBP1 Peptide - middle region

Product Specifications

Product Name Alternative

MGC117406, MGC130052, MGC130053, NBP, NBP1

UniProt

P53384

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUBP1 Rabbit Polyclonal Antibody (orb583125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002475

Preservative

Lyophilized powder

AA Sequence

SGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHLPP antibody
70R-51367 100 ul

PHLPP antibody

Sign In for Pricing
View Details
PAG608 Rabbit pAb, IRDye 800CW conjugated
orb2849454 100 µL

PAG608 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Nori® Donkey IGF2 ELISA Kit
GR170135 96 Well

Nori® Donkey IGF2 ELISA Kit

Sign In for Pricing
View Details
ABCG8 (ATP Binding Cassette, Subfamily G, Member 8, GBD4, STSL) (MaxLight 750)
MBS6405066-01 0.1 mL

ABCG8 (ATP Binding Cassette, Subfamily G, Member 8, GBD4, STSL) (MaxLight 750)

Sign In for Pricing
View Details
ABCG8 (ATP Binding Cassette, Subfamily G, Member 8, GBD4, STSL) (MaxLight 750)
MBS6405066-02 5x 0.1 mL

ABCG8 (ATP Binding Cassette, Subfamily G, Member 8, GBD4, STSL) (MaxLight 750)

Sign In for Pricing
View Details
Human ABRACL Protein
orb423917-01 5 µg

Human ABRACL Protein

Sign In for Pricing
View Details