Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUBP1 Peptide - middle region

NUBP1 Peptide - middle region

Product Specifications

Product Name Alternative

MGC117406, MGC130052, MGC130053, NBP, NBP1

UniProt

P53384

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUBP1 Rabbit Polyclonal Antibody (orb583125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002475

Preservative

Lyophilized powder

AA Sequence

SGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC38A9 Antibody, FITC conjugated
MBS7044764-01 0.05 mg

SLC38A9 Antibody, FITC conjugated

Sign In for Pricing
View Details
SLC38A9 Antibody, FITC conjugated
MBS7044764-02 0.1 mg

SLC38A9 Antibody, FITC conjugated

Sign In for Pricing
View Details
SLC38A9 Antibody, FITC conjugated
MBS7044764-03 5x 0.1 mg

SLC38A9 Antibody, FITC conjugated

Sign In for Pricing
View Details
Human UGT1A10 Knockout HEK293T cell line
GTR15404952 1 Vial

Human UGT1A10 Knockout HEK293T cell line

Sign In for Pricing
View Details
N6- (6-Aminohexyl) -ATP-ATTO-565
orb63395 120 µL

N6- (6-Aminohexyl) -ATP-ATTO-565

Sign In for Pricing
View Details
AADACL1, Control Peptide (Neutral Cholesterol Ester Hydrolase 1, NCEH, Arylacetamide Deacetylase-like 1, NCEH1, KIAA1363)
148699 100 µg

AADACL1, Control Peptide (Neutral Cholesterol Ester Hydrolase 1, NCEH, Arylacetamide Deacetylase-like 1, NCEH1, KIAA1363)

Sign In for Pricing
View Details