Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nudt15 Peptide - N-terminal region

Nudt15 Peptide - N-terminal region

Product Specifications

Product Name Alternative

6530403O17, A730068G11Rik, MTH2

UniProt

Q8BG93

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nudt15 Rabbit Polyclonal Antibody (orb580537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766115

Preservative

Lyophilized powder

AA Sequence

RKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLHLKNVCFASVVNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-100 1x 100 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-500 1x 500 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-500 1x 500 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-100 1x 100 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-500 1x 500 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details