Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT2 Peptide - middle region

NUDT2 Peptide - middle region

Product Specifications

Product Name Alternative

APAH1, MGC10404

UniProt

P50583

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT2 Rabbit Polyclonal Antibody (orb585400) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_671702

Preservative

Lyophilized powder

AA Sequence

ETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ERGIC3
orb1133098 100 µL

Anti-ERGIC3

Sign In for Pricing
View Details
Bakkenolide D
orb1683096-01 1 mg

Bakkenolide D

Sign In for Pricing
View Details
Bakkenolide D
orb1683096-02 5 mg

Bakkenolide D

Sign In for Pricing
View Details
Bakkenolide D
orb1683096-03 10 mg

Bakkenolide D

Sign In for Pricing
View Details
Bakkenolide D
orb1683096-04 25 mg

Bakkenolide D

Sign In for Pricing
View Details
Ksr-1 Double Nickase Plasmid (m2)
sc-421364-NIC-2 20 µg

Ksr-1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details