Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT2 Peptide - middle region

NUDT2 Peptide - middle region

Product Specifications

Product Name Alternative

APAH1, MGC10404

UniProt

P50583

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT2 Rabbit Polyclonal Antibody (orb585400) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_671702

Preservative

Lyophilized powder

AA Sequence

ETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stmn1 (NM_019641) Mouse Recombinant Protein
E45M42581M5 20 µg

Stmn1 (NM_019641) Mouse Recombinant Protein

Sign In for Pricing
View Details
Phospho-PI 3 Kinase p110 delta (Tyr524) Rabbit Polyclonal Antibody (HRP)
orb503041 100 µL

Phospho-PI 3 Kinase p110 delta (Tyr524) Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal SHANK1 Antibody [PerCP]
NB300-166PCP 0.1 mL

Rabbit Polyclonal SHANK1 Antibody [PerCP]

Sign In for Pricing
View Details
MYO1E Antibody, FITC conjugated
A55377-100UG 100 µg

MYO1E Antibody, FITC conjugated

Sign In for Pricing
View Details
Phospho-CD19 (Tyr531) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-3065R-BF350 100 µL

Phospho-CD19 (Tyr531) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
BOP1 Rabbit Polyclonal Antibody
orb579718 100 µL

BOP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details