Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nxph1 Peptide - N-terminal region

Nxph1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C130005L03Rik

UniProt

Q61200

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nxph1 Rabbit Polyclonal Antibody (orb582788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032777

Preservative

Lyophilized powder

AA Sequence

LLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tilorone Dihydrochloride
TRC-T440800-1G 1 g

Tilorone Dihydrochloride

Sign In for Pricing
View Details
Frozen Tissue Blocks, Joint
CB626705 1 Block

Frozen Tissue Blocks, Joint

Sign In for Pricing
View Details
E2F5 (NM_001951) Human Over-expression Lysate
LY419631 100 µg

E2F5 (NM_001951) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Phenylpropyl Alverine
TRC-P575780-250MG 250 mg

N-Phenylpropyl Alverine

Sign In for Pricing
View Details
Uncoated Human D2D (D-Dimer) ELISA Kit
E-UNEL-H0036-01 5x 96 Tests

Uncoated Human D2D (D-Dimer) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human D2D (D-Dimer) ELISA Kit
E-UNEL-H0036-02 15x 96 Tests

Uncoated Human D2D (D-Dimer) ELISA Kit

Sign In for Pricing
View Details