Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nxph1 Peptide - N-terminal region

Nxph1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C130005L03Rik

UniProt

Q61200

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nxph1 Rabbit Polyclonal Antibody (orb582788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032777

Preservative

Lyophilized powder

AA Sequence

LLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Acid Tartrate
TRC-E679620-250MG 250 mg

Ethyl Acid Tartrate

Sign In for Pricing
View Details
TBC1D3 (TBC1D3F) Human Gene Knockout Kit (CRISPR)
KN416396 1 Kit

TBC1D3 (TBC1D3F) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
AP20707PU-N 100 µg

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (V395I) (His Tag)
PKSV030444 100 µg

Recombinant SARS-CoV-2 Spike RBD (V395I) (His Tag)

Sign In for Pricing
View Details
LMX1B (NM_001174147) Human Over-expression Lysate
LC433007 20 µg

LMX1B (NM_001174147) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human FOLR2/FBP Protein (His Tag)
PKSH031199 100 µg

Recombinant Human FOLR2/FBP Protein (His Tag)

Sign In for Pricing
View Details