Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH3 Peptide - N-terminal region

NXPH3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NPH3

UniProt

Q9Z2N5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NXPH3 Rabbit Polyclonal Antibody (orb581658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009156

Preservative

Lyophilized powder

AA Sequence

RDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd47 Mouse Gene Knockout Kit (CRISPR)
KN502922 1 Kit

Cd47 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BDKRB1 (NM_000710) Human Over-expression Lysate
LC400238 20 µg

BDKRB1 (NM_000710) Human Over-expression Lysate

Sign In for Pricing
View Details
Diphenyl Carbonate
TRC-D415295-50G 50 g

Diphenyl Carbonate

Sign In for Pricing
View Details
Tissue Total RNA, Unknown tissue
CR562973 5 µg

Tissue Total RNA, Unknown tissue

Sign In for Pricing
View Details
CEVd TaqMan RT-PCR Kit
TM47650 100 Reactions

CEVd TaqMan RT-PCR Kit

Sign In for Pricing
View Details
Recombinant MRE11 Antibody
RC-6706-01 50 μL

Recombinant MRE11 Antibody

Sign In for Pricing
View Details