Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH3 Peptide - N-terminal region

NXPH3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NPH3

UniProt

Q9Z2N5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NXPH3 Rabbit Polyclonal Antibody (orb581658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009156

Preservative

Lyophilized powder

AA Sequence

RDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PRR14 activation kit by CRISPRa
GA112295 1 Kit

Human PRR14 activation kit by CRISPRa

Sign In for Pricing
View Details
Caldiamide Sodium
TRC-C145690-1G 1 g

Caldiamide Sodium

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR562832 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
Aβ40 Polyclonal Antibody
E-AB-40070-01 25 µL

Aβ40 Polyclonal Antibody

Sign In for Pricing
View Details
Aβ40 Polyclonal Antibody
E-AB-40070-02 100 µL

Aβ40 Polyclonal Antibody

Sign In for Pricing
View Details
NOV Polyclonal Antibody
E-AB-15124-01 20 µL

NOV Polyclonal Antibody

Sign In for Pricing
View Details