Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH3 Peptide - middle region

NXPH3 Peptide - middle region

Product Specifications

Product Name Alternative

NPH3

UniProt

Q9Z2N5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NXPH3 Rabbit Polyclonal Antibody (orb581659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009156

Preservative

Lyophilized powder

AA Sequence

NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KLF6 Antibody (3C4)
H00001316-M02 0.1 mg

Mouse Monoclonal KLF6 Antibody (3C4)

Sign In for Pricing
View Details
STAT4 Antibody
orb1268813 400 μl

STAT4 Antibody

Sign In for Pricing
View Details
Acid Sphingomyelinase antibody
70R-50403 100 µL

Acid Sphingomyelinase antibody

Sign In for Pricing
View Details
Olfr975 Protein Vector (Mouse) (pPB-N-His)
PV212267 500 ng

Olfr975 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
SMAD7 Rabbit Polyclonal Antibody
orb574015 100 µL

SMAD7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Maltotetraose
BA1255-5.1 1 mL (10 mM in Water)

Maltotetraose

Sign In for Pricing
View Details