Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH3 Peptide - middle region

NXPH3 Peptide - middle region

Product Specifications

Product Name Alternative

NPH3

UniProt

Q9Z2N5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NXPH3 Rabbit Polyclonal Antibody (orb581659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009156

Preservative

Lyophilized powder

AA Sequence

NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein CIII (APOC3) (NM_000040) Human Over-expression Lysate
E45H20260-2 20 µg

Apolipoprotein CIII (APOC3) (NM_000040) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Neurochondrin (NCDN) ELISA Kit
RD-NCDN-Hu-01 96 Tests

Human Neurochondrin (NCDN) ELISA Kit

Sign In for Pricing
View Details
Human Neurochondrin (NCDN) ELISA Kit
RD-NCDN-Hu-02 48 Tests

Human Neurochondrin (NCDN) ELISA Kit

Sign In for Pricing
View Details
Recombinant human EMR1 protein, C-His (HEK293)
orb2837152-01 20 µg

Recombinant human EMR1 protein, C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human EMR1 protein, C-His (HEK293)
orb2837152-02 100 µg

Recombinant human EMR1 protein, C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human EMR1 protein, C-His (HEK293)
orb2837152-03 500 µg

Recombinant human EMR1 protein, C-His (HEK293)

Sign In for Pricing
View Details