Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Oasl1 Peptide - C-terminal region

Oasl1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

7530414C13Rik, oasl9

UniProt

Q8VI94

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Oasl1 Rabbit Polyclonal Antibody (orb324864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660210

Preservative

Lyophilized powder

AA Sequence

ICLLDTISPEIQVFVKNPDGRSHAYAIHPLDYVLNLKQQIEDRQGLRCQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubl4a Mouse Gene Knockout Kit (CRISPR)
KN518605 1 Kit

Ubl4a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), CF594 conjugate, 0.1mg/mL
BNC941902-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HMGCS1 Recombinant Rabbit Monoclonal Antibody [PSH08-51]
HA722997 100 µL

HMGCS1 Recombinant Rabbit Monoclonal Antibody [PSH08-51]

Sign In for Pricing
View Details
Recombinant NSE Monoclonal Antibody
AN301611L-01 50 µL

Recombinant NSE Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant NSE Monoclonal Antibody
AN301611L-02 100 µL

Recombinant NSE Monoclonal Antibody

Sign In for Pricing
View Details
Armc7 Mouse Gene Knockout Kit (CRISPR)
KN501594 1 Kit

Armc7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details