Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Oasl1 Peptide - C-terminal region

Oasl1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

7530414C13Rik, oasl9

UniProt

Q8VI94

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Oasl1 Rabbit Polyclonal Antibody (orb324864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660210

Preservative

Lyophilized powder

AA Sequence

ICLLDTISPEIQVFVKNPDGRSHAYAIHPLDYVLNLKQQIEDRQGLRCQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PCSK9 protein (His tag)
PDMH100413-01 20 µg

Recombinant Human PCSK9 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PCSK9 protein (His tag)
PDMH100413-02 100 µg

Recombinant Human PCSK9 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PCSK9 protein (His tag)
PDMH100413-03 500 µg

Recombinant Human PCSK9 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PCSK9 protein (His tag)
PDMH100413-04 1 mg

Recombinant Human PCSK9 protein (His tag)

Sign In for Pricing
View Details
Claudin18 Rabbit Polyclonal Antibody
HA500131 100 µL

Claudin18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Penten-1-amine Hydrochloride
TRC-P227403-2.5G 2.5 g

4-Penten-1-amine Hydrochloride

Sign In for Pricing
View Details