Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OAZ3 Peptide - middle region

OAZ3 Peptide - middle region

Product Specifications

Product Name Alternative

AZ3, OAZ-t, TISP15

UniProt

Q9UMX2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OAZ3 Rabbit Polyclonal Antibody (orb582189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057262

Preservative

Lyophilized powder

AA Sequence

DRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant FOXP3 Antibody
RC-15509-01 50 μL

Recombinant FOXP3 Antibody

Sign In for Pricing
View Details
Recombinant FOXP3 Antibody
RC-15509-02 100 µL

Recombinant FOXP3 Antibody

Sign In for Pricing
View Details
Recombinant FOXP3 Antibody
RC-15509-03 1 mL

Recombinant FOXP3 Antibody

Sign In for Pricing
View Details
MEF2A (Ab-319) Antibody
8B7145-AAT 50 µg

MEF2A (Ab-319) Antibody

Sign In for Pricing
View Details
Human PPM1J activation kit by CRISPRa
GA117334 1 Kit

Human PPM1J activation kit by CRISPRa

Sign In for Pricing
View Details
(R)-(-)-Norlaudanosine Hydrochloride
TRC-N661415-2.5G 2.5 g

(R)-(-)-Norlaudanosine Hydrochloride

Sign In for Pricing
View Details