Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OAZ3 Peptide - middle region

OAZ3 Peptide - middle region

Product Specifications

Product Name Alternative

AZ3, OAZ-t, TISP15

UniProt

Q9UMX2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OAZ3 Rabbit Polyclonal Antibody (orb582189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057262

Preservative

Lyophilized powder

AA Sequence

DRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse FLT-3/FLK-2 Protein (His Tag)
PKSM040347 50 µg

Recombinant Mouse FLT-3/FLK-2 Protein (His Tag)

Sign In for Pricing
View Details
Reps2 Mouse Gene Knockout Kit (CRISPR)
KN514669 1 Kit

Reps2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dianion HP-20 Resin
TRC-D416514-50G 50 g

Dianion HP-20 Resin

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS622549 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
QuicKey Pro Rat ACE2 (Angiotensin I Converting Enzyme 2) ELISA Kit
E-OSEL-R0012-01 24 Tests

QuicKey Pro Rat ACE2 (Angiotensin I Converting Enzyme 2) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Rat ACE2 (Angiotensin I Converting Enzyme 2) ELISA Kit
E-OSEL-R0012-02 48 Tests

QuicKey Pro Rat ACE2 (Angiotensin I Converting Enzyme 2) ELISA Kit

Sign In for Pricing
View Details