Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STN1 Peptide - C-terminal region

STN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AAF44, OBFC1, AAF-44, RPA-32, bA541N10.2

UniProt

Q9H668

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STN1 Rabbit Polyclonal Antibody (orb585375) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079204

Preservative

Lyophilized powder

AA Sequence

DKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (Chloromethyl) -5H,6H,7H-pyrrolo[1,2-b][1,2,4]triazole hydrochloride
JHD93781-01 50 mg

5- (Chloromethyl) -5H,6H,7H-pyrrolo[1,2-b][1,2,4]triazole hydrochloride

Sign In for Pricing
View Details
5- (Chloromethyl) -5H,6H,7H-pyrrolo[1,2-b][1,2,4]triazole hydrochloride
JHD93781-02 0.5 g

5- (Chloromethyl) -5H,6H,7H-pyrrolo[1,2-b][1,2,4]triazole hydrochloride

Sign In for Pricing
View Details
SHOX (NM_000451) Human Over-expression Lysate
LY424707 100 µg

SHOX (NM_000451) Human Over-expression Lysate

Sign In for Pricing
View Details
SPI1 (Transcription Factor PU.1, 31kD-transforming Protein) (PE)
MBS6394937-01 0.1 mL

SPI1 (Transcription Factor PU.1, 31kD-transforming Protein) (PE)

Sign In for Pricing
View Details
SPI1 (Transcription Factor PU.1, 31kD-transforming Protein) (PE)
MBS6394937-02 5x 0.1 mL

SPI1 (Transcription Factor PU.1, 31kD-transforming Protein) (PE)

Sign In for Pricing
View Details
D630003M21Rik Mouse qPCR Primer Pair (NM_177657)
MP214642 200 Reactions

D630003M21Rik Mouse qPCR Primer Pair (NM_177657)

Sign In for Pricing
View Details