Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STN1 Peptide - C-terminal region

STN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AAF44, OBFC1, AAF-44, RPA-32, bA541N10.2

UniProt

Q9H668

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STN1 Rabbit Polyclonal Antibody (orb585375) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079204

Preservative

Lyophilized powder

AA Sequence

DKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse PIP5K1A Protein, His (Fc)-Avi-tagged
PIP5K1A-6755M 50 µg

Recombinant Mouse PIP5K1A Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Recombinant Human proANP Protein - (Dry Ice)
H00004878-P01-25ug 25 µg

Recombinant Human proANP Protein - (Dry Ice)

Sign In for Pricing
View Details
Human Coagulation Factor XIII A1 Polypeptide (F13A1) ELISA Kit
MBS2019363-01 24 Strip Well

Human Coagulation Factor XIII A1 Polypeptide (F13A1) ELISA Kit

Sign In for Pricing
View Details
Human Coagulation Factor XIII A1 Polypeptide (F13A1) ELISA Kit
MBS2019363-02 48 Well

Human Coagulation Factor XIII A1 Polypeptide (F13A1) ELISA Kit

Sign In for Pricing
View Details
Human Coagulation Factor XIII A1 Polypeptide (F13A1) ELISA Kit
MBS2019363-03 96 Well

Human Coagulation Factor XIII A1 Polypeptide (F13A1) ELISA Kit

Sign In for Pricing
View Details
Human Coagulation Factor XIII A1 Polypeptide (F13A1) ELISA Kit
MBS2019363-04 5x 96 Well

Human Coagulation Factor XIII A1 Polypeptide (F13A1) ELISA Kit

Sign In for Pricing
View Details