Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ociad2 Peptide - N-terminal region

Ociad2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1810027I20Rik, MGC51598

UniProt

Q9D8W7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ociad2 Rabbit Polyclonal Antibody (orb581887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081226

Preservative

Lyophilized powder

AA Sequence

MASVSTHGNQEKSPHLPPLSKQSLLFCPKSKLHIHRGEIAKIIRECQEES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRADD (TNFRSF1A-Associated via Death Domain, Hs.89862, MGC11078) (MaxLight 750)
MBS6241161-01 0.1 mL

TRADD (TNFRSF1A-Associated via Death Domain, Hs.89862, MGC11078) (MaxLight 750)

Sign In for Pricing
View Details
TRADD (TNFRSF1A-Associated via Death Domain, Hs.89862, MGC11078) (MaxLight 750)
MBS6241161-02 5x 0.1 mL

TRADD (TNFRSF1A-Associated via Death Domain, Hs.89862, MGC11078) (MaxLight 750)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: left upper lobe
CS546444 5x 5 µm

Frozen Tissue Sections, Lung: left upper lobe

Sign In for Pricing
View Details
AZD5153 250mg
A24388-250 250 mg

AZD5153 250mg

Sign In for Pricing
View Details
PSH-EFIRES-B-AtAFB2-mCherry
ELKP573 20 µL Plasmid

PSH-EFIRES-B-AtAFB2-mCherry

Sign In for Pricing
View Details
NARS (Asparaginyl-tRNA Synthetase, ASNRS, NARS1) (MaxLight 550)
MBS6218190-01 0.1 mL

NARS (Asparaginyl-tRNA Synthetase, ASNRS, NARS1) (MaxLight 550)

Sign In for Pricing
View Details