Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Odf1 Peptide - middle region

Odf1 Peptide - middle region

Product Specifications

UniProt

Q61999

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Odf1 Rabbit Polyclonal Antibody (orb582217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032783

Preservative

Lyophilized powder

AA Sequence

VCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DNA Antibody (163.1)
RGK23849 100 μg

Anti-DNA Antibody (163.1)

Sign In for Pricing
View Details
FITC Anti-Mouse Foxp3 Antibody (3G3)
MBS7620430-01 50 Tests

FITC Anti-Mouse Foxp3 Antibody (3G3)

Sign In for Pricing
View Details
FITC Anti-Mouse Foxp3 Antibody (3G3)
MBS7620430-02 100 Tests

FITC Anti-Mouse Foxp3 Antibody (3G3)

Sign In for Pricing
View Details
FITC Anti-Mouse Foxp3 Antibody (3G3)
MBS7620430-03 5x 100 Tests

FITC Anti-Mouse Foxp3 Antibody (3G3)

Sign In for Pricing
View Details
CCNG1 Recombinant Protein (Rat)
RP193724 100 µg

CCNG1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Recombinant Asp f 34
A10V87 1 Each

Recombinant Asp f 34

Sign In for Pricing
View Details