Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Odf1 Peptide - middle region

Odf1 Peptide - middle region

Product Specifications

UniProt

Q61999

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Odf1 Rabbit Polyclonal Antibody (orb582217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032783

Preservative

Lyophilized powder

AA Sequence

VCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine anti gliadin antibody ELISA Kit
MBS7278308-01 48 Well

Bovine anti gliadin antibody ELISA Kit

Sign In for Pricing
View Details
Bovine anti gliadin antibody ELISA Kit
MBS7278308-02 96 Well

Bovine anti gliadin antibody ELISA Kit

Sign In for Pricing
View Details
Bovine anti gliadin antibody ELISA Kit
MBS7278308-03 5x 96 Well

Bovine anti gliadin antibody ELISA Kit

Sign In for Pricing
View Details
Bovine anti gliadin antibody ELISA Kit
MBS7278308-04 10x 96 Well

Bovine anti gliadin antibody ELISA Kit

Sign In for Pricing
View Details
2-chloro-4- nitrophenyl-α-L-fucopyranoside
HH4701-03 50 g

2-chloro-4- nitrophenyl-α-L-fucopyranoside

Sign In for Pricing
View Details
DYSFIP1, NT (PPP1R27, DYSFIP1, Protein phosphatase 1 regulatory subunit 27, Dysferlin-interacting protein 1, Toonin)
MBS648518-01 0.2 mL

DYSFIP1, NT (PPP1R27, DYSFIP1, Protein phosphatase 1 regulatory subunit 27, Dysferlin-interacting protein 1, Toonin)

Sign In for Pricing
View Details