Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ODF2 Peptide - N-terminal region

ODF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ44866, MGC111096, MGC9034, ODF2/1, ODF2/2, ODF84, CT134

UniProt

B4DX85

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ODF2 Rabbit Polyclonal Antibody (orb582247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_702915

Preservative

Lyophilized powder

AA Sequence

MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filcons Cup type Non Sterile - 50µm
150-47N/3 300 Units

Filcons Cup type Non Sterile - 50µm

Sign In for Pricing
View Details
Bovine Cystatin-D (CST5) ELISA Kit
MBS7251813-01 48 Well

Bovine Cystatin-D (CST5) ELISA Kit

Sign In for Pricing
View Details
Bovine Cystatin-D (CST5) ELISA Kit
MBS7251813-02 96 Well

Bovine Cystatin-D (CST5) ELISA Kit

Sign In for Pricing
View Details
Bovine Cystatin-D (CST5) ELISA Kit
MBS7251813-03 5x 96 Well

Bovine Cystatin-D (CST5) ELISA Kit

Sign In for Pricing
View Details
Bovine Cystatin-D (CST5) ELISA Kit
MBS7251813-04 10x 96 Well

Bovine Cystatin-D (CST5) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human DDX51 sgRNA gene knockout kit - Lentiviral human DDX51 sgRNA gene knockout kit (25)
GTR15355685 1 Vial

Lentiviral human DDX51 sgRNA gene knockout kit - Lentiviral human DDX51 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details