Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ODF2 Peptide - N-terminal region

ODF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ44866, MGC111096, MGC9034, ODF2/1, ODF2/2, ODF84, CT134

UniProt

B4DX85

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ODF2 Rabbit Polyclonal Antibody (orb582247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_702915

Preservative

Lyophilized powder

AA Sequence

MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human EXOC5 Polyclonal Antibody
PHA13001 100 μg

Anti-Human EXOC5 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Fasciclin-like arabinogalactan protein 6 (FLA6)
MBS1400840-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Fasciclin-like arabinogalactan protein 6 (FLA6)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Fasciclin-like arabinogalactan protein 6 (FLA6)
MBS1400840-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Fasciclin-like arabinogalactan protein 6 (FLA6)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Fasciclin-like arabinogalactan protein 6 (FLA6)
MBS1400840-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Fasciclin-like arabinogalactan protein 6 (FLA6)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Fasciclin-like arabinogalactan protein 6 (FLA6)
MBS1400840-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Fasciclin-like arabinogalactan protein 6 (FLA6)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Fasciclin-like arabinogalactan protein 6 (FLA6)
MBS1400840-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Fasciclin-like arabinogalactan protein 6 (FLA6)

Sign In for Pricing
View Details