Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OGG1 Peptide - C-terminal region

OGG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HMMH, HOGG1, MUTM, OGH1

UniProt

O15527

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OGG1 Rabbit Polyclonal Antibody (orb331128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058438

Preservative

Lyophilized powder

AA Sequence

AVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VILIP1 (VSNL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F11]
TA802023AM 100 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F11]

Sign In for Pricing
View Details
PDE6 gamma (PDE6G) (NM_002602) Human Over-expression Lysate
LC419220 20 µg

PDE6 gamma (PDE6G) (NM_002602) Human Over-expression Lysate

Sign In for Pricing
View Details
RTL10 (NM_024627) Human Recombinant Protein
TP303371M 100 µg

RTL10 (NM_024627) Human Recombinant Protein

Sign In for Pricing
View Details
UHRF2 Antibody
KC-2254-01 50 μL

UHRF2 Antibody

Sign In for Pricing
View Details
UHRF2 Antibody
KC-2254-02 100 µL

UHRF2 Antibody

Sign In for Pricing
View Details
UHRF2 Antibody
KC-2254-03 1 mL

UHRF2 Antibody

Sign In for Pricing
View Details