Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfm3 Peptide - C-terminal region

Olfm3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B230206G02Rik

UniProt

P63056

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olfm3 Rabbit Polyclonal Antibody (orb581720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694797

Preservative

Lyophilized powder

AA Sequence

PKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HPi4 Antibody (HIC1-5F10)
NBP1-18948 0.1 mL

Mouse Monoclonal HPi4 Antibody (HIC1-5F10)

Sign In for Pricing
View Details
Amyloid Dan Protein (1-34)
MBS8246082-01 1 mg

Amyloid Dan Protein (1-34)

Sign In for Pricing
View Details
Amyloid Dan Protein (1-34)
MBS8246082-02 5 mg

Amyloid Dan Protein (1-34)

Sign In for Pricing
View Details
Amyloid Dan Protein (1-34)
MBS8246082-03 10 mg

Amyloid Dan Protein (1-34)

Sign In for Pricing
View Details
Amyloid Dan Protein (1-34)
MBS8246082-04 5x 10 mg

Amyloid Dan Protein (1-34)

Sign In for Pricing
View Details
Cwc22 (NM_030560) Mouse Tagged ORF Clone Lentiviral Particle
MR218485L4V 200 µL

Cwc22 (NM_030560) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details