Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olig1 Peptide - middle region

Olig1 Peptide - middle region

Product Specifications

Product Name Alternative

Olg1

UniProt

Q9WUQ3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olig1 Rabbit Polyclonal Antibody (orb330458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068538

Preservative

Lyophilized powder

AA Sequence

LRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MANSC1 (MANSC Domain Containing Protein 1) ELISA Kit
EH25867 96 Tests

Human MANSC1 (MANSC Domain Containing Protein 1) ELISA Kit

Sign In for Pricing
View Details
GIPR/GIP Receptor Antibody
orb1534036 50 µg

GIPR/GIP Receptor Antibody

Sign In for Pricing
View Details
MSX1 (msh Homeobox 1, HOX7, HYD1) (AP) discontinued
248973-AP 100 µL

MSX1 (msh Homeobox 1, HOX7, HYD1) (AP) discontinued

Sign In for Pricing
View Details
N- (4-hydroxycyclohexyl) acetamide-d10
HY-W706083-01 10 mg

N- (4-hydroxycyclohexyl) acetamide-d10

Sign In for Pricing
View Details
N- (4-hydroxycyclohexyl) acetamide-d10
HY-W706083-02 25 mg

N- (4-hydroxycyclohexyl) acetamide-d10

Sign In for Pricing
View Details
Phospho-PTEN (Ser385) Antibody Blocking Peptide
orb1507619 500 µg

Phospho-PTEN (Ser385) Antibody Blocking Peptide

Sign In for Pricing
View Details