Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olig3 Peptide - N-terminal region

Olig3 Peptide - N-terminal region

Product Specifications

UniProt

D4A572

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olig3 Rabbit Polyclonal Antibody (orb575887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099739

Preservative

Lyophilized powder

AA Sequence

AKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isoconazole Nitrate
TRC-I798250-1G 1 g

Isoconazole Nitrate

Sign In for Pricing
View Details
Tal1 Rabbit Polyclonal Antibody
TA362947 100 µL

Tal1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cmtr1 Mouse Gene Knockout Kit (CRISPR)
KN503530 1 Kit

Cmtr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calprotectin (MRP14) (S100A9) (CAGB/426), 0.2mg/mL
BNUB0426-500 1x 500 µL

Calprotectin (MRP14) (S100A9) (CAGB/426), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human LILRB2/CD85d Protein (His Tag)
PKSH032698-01 10 µg

Recombinant Human LILRB2/CD85d Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LILRB2/CD85d Protein (His Tag)
PKSH032698-02 50 µg

Recombinant Human LILRB2/CD85d Protein (His Tag)

Sign In for Pricing
View Details