Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olig3 Peptide - N-terminal region

Olig3 Peptide - N-terminal region

Product Specifications

UniProt

D4A572

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olig3 Rabbit Polyclonal Antibody (orb575887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099739

Preservative

Lyophilized powder

AA Sequence

AKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF594 conjugate, 0.1mg/mL
BNC940810-100 1x 100 µL

AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), CF405S conjugate, 0.1mg/mL
BNC040521-100 1x 100 µL

AFP (Alpha Fetoprotein) (MBS-12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MELK (NM_014791) Human Over-expression Lysate
LY402376 100 µg

MELK (NM_014791) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethylamine Solution (2.0 M In Meoh)
TRC-E945723-50ML 50 mL

Ethylamine Solution (2.0 M In Meoh)

Sign In for Pricing
View Details
Recombinant MAP2 Monoclonal Antibody
AN300528P 100 µL

Recombinant MAP2 Monoclonal Antibody

Sign In for Pricing
View Details
AADAC (NM_001086) Human Over-expression Lysate
LC421330 20 µg

AADAC (NM_001086) Human Over-expression Lysate

Sign In for Pricing
View Details