OMA1 Peptide - middle region
OMA1 Peptide - middle region
Product Specifications
Product Name Alternative
2010001O09Rik, DAB1, FLJ33782, MPRP-1, YKR087C, ZMPOMA1
UniProt
Q96E52
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OMA1 Rabbit Polyclonal Antibody (orb581846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_660286
Preservative
Lyophilized powder
AA Sequence
WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV654734 1.0 µg DNA
TRAF3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details 
P4258-17K-ML550 100 µL
PDGFB, CT (Platelet-derived Growth Factor Subunit B, PDGF Subunit B, Platelet-derived Growth Factor B Chain, Platelet-derived Growth Factor beta Polypeptide, PDGF-2, Proto-oncogene c-Sis, Becaplermin, PDGF2, SIS) (MaxLight 550) discontinued
Sign In for Pricing
View Details RG228203 10 µg
Aspartate beta hydroxylase (ASPH) (NM_001164755) Human Tagged ORF Clone
Sign In for Pricing
View Details 111235 900 Pack (36 Label (s) x 25 Card)
HH-V-PK Adhesive-backed Markers
Sign In for Pricing
View Details 
EK12F714-01 48 Test
Porcine Toll-Like Receptor 9 (TLR9) ELISA Kit-Sandwich
Sign In for Pricing
View Details EK12F714-02 96 Tests
Porcine Toll-Like Receptor 9 (TLR9) ELISA Kit-Sandwich
Sign In for Pricing
View Details