Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMA1 Peptide - middle region

OMA1 Peptide - middle region

Product Specifications

Product Name Alternative

2010001O09Rik, DAB1, FLJ33782, MPRP-1, YKR087C, ZMPOMA1

UniProt

Q96E52

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OMA1 Rabbit Polyclonal Antibody (orb581846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660286

Preservative

Lyophilized powder

AA Sequence

WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-Tox-3xFLAG-Neo Plasmid
PVT72477 2 µg

PCMV-Tox-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
ABCC8 siRNA (Human)
MBS8205897-01 15 nmol

ABCC8 siRNA (Human)

Sign In for Pricing
View Details
ABCC8 siRNA (Human)
MBS8205897-02 30 nmol

ABCC8 siRNA (Human)

Sign In for Pricing
View Details
ABCC8 siRNA (Human)
MBS8205897-03 5x 30 nmol

ABCC8 siRNA (Human)

Sign In for Pricing
View Details
LATS2 (Phospho-Ser1027) Polyclonal Conjugated Antibody
MBS9438214-01 0.1 mL (AF350)

LATS2 (Phospho-Ser1027) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
LATS2 (Phospho-Ser1027) Polyclonal Conjugated Antibody
MBS9438214-02 0.1 mL (AF405)

LATS2 (Phospho-Ser1027) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details