Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMG Peptide - N-terminal region

OMG Peptide - N-terminal region

Product Specifications

Product Name Alternative

OMGP

UniProt

P23515

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OMG Rabbit Polyclonal Antibody (orb330409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002535

Preservative

Lyophilized powder

AA Sequence

ANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Biotinyl-N’-Boc-1,6-hexanediamine
TRC-B395300-100MG 100 mg

N-Biotinyl-N’-Boc-1,6-hexanediamine

Sign In for Pricing
View Details
MCCC1 Protein Vector (Rat) (pPM-C-HA)
PV281464 500 ng

MCCC1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Transposase for insertion sequence element IS21-like (tnpA), partial
MBS1452322 Inquire

Recombinant Transposase for insertion sequence element IS21-like (tnpA), partial

Sign In for Pricing
View Details
HORMAD1 Antibody Blocking peptide
orb1452517 500 µg

HORMAD1 Antibody Blocking peptide

Sign In for Pricing
View Details
LOC157589 Human qPCR Primer Pair (XM_005042)
HP220723 200 Reactions

LOC157589 Human qPCR Primer Pair (XM_005042)

Sign In for Pricing
View Details
Myoglobin, Cardiac (MB) (MaxLight 405)
MBS6489045-01 0.1 mL

Myoglobin, Cardiac (MB) (MaxLight 405)

Sign In for Pricing
View Details