OMG Peptide - N-terminal region
OMG Peptide - N-terminal region
Product Specifications
Product Name Alternative
OMGP
UniProt
P23515
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OMG Rabbit Polyclonal Antibody (orb330409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002535
Preservative
Lyophilized powder
AA Sequence
ANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6012514-01 0.05 mg
Prostein, NT (Solute Carrier Family 45 Member 3, Prostate Cancer-associated Protein 6, SLC45A3, PCANAP6, PRST)
Sign In for Pricing
View Details MBS6012514-02 5x 0.05 mg
Prostein, NT (Solute Carrier Family 45 Member 3, Prostate Cancer-associated Protein 6, SLC45A3, PCANAP6, PRST)
Sign In for Pricing
View Details 
MBS6137489-01 0.1 mL
MAGED2 (Melanoma-associated Antigen D2, MAGE-D2 Antigen, Breast Cancer-associated Gene 1 Protein, BCG-1, 11B6, Hepatocellular Carcinoma-associated Protein JCL-1, BCG1) APC
Sign In for Pricing
View Details MBS6137489-02 5x 0.1 mL
MAGED2 (Melanoma-associated Antigen D2, MAGE-D2 Antigen, Breast Cancer-associated Gene 1 Protein, BCG-1, 11B6, Hepatocellular Carcinoma-associated Protein JCL-1, BCG1) APC
Sign In for Pricing
View Details 
