Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Onecut1 Peptide - C-terminal region

Onecut1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D9Ertd423e, Hfh12, Hnf6, Hnf6b, OC-1, Oc1, HNF-6

UniProt

O08755

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Onecut1 Rabbit Polyclonal Antibody (orb573980) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_032288

Preservative

Lyophilized powder

AA Sequence

CKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloropyrimidine-d3 (Major)
TRC-C380852-1MG 1 mg

2-Chloropyrimidine-d3 (Major)

Sign In for Pricing
View Details
Chlorodifluoro-acetic Acid Sodium Salt
TRC-C365460-50G 50 g

Chlorodifluoro-acetic Acid Sodium Salt

Sign In for Pricing
View Details
LY9 Polyclonal Antibody
E-AB-90042-01 60 µL

LY9 Polyclonal Antibody

Sign In for Pricing
View Details
LY9 Polyclonal Antibody
E-AB-90042-02 120 µL

LY9 Polyclonal Antibody

Sign In for Pricing
View Details
LY9 Polyclonal Antibody
E-AB-90042-03 200 µL

LY9 Polyclonal Antibody

Sign In for Pricing
View Details
KIR3DP1 (NM_001015070) Human Over-expression Lysate
LY423123 100 µg

KIR3DP1 (NM_001015070) Human Over-expression Lysate

Sign In for Pricing
View Details