Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Onecut3 Peptide - C-terminal region

Onecut3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OC-3, Oc3

UniProt

Q8K557

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Onecut3 Rabbit Polyclonal Antibody (orb576321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631972

Preservative

Lyophilized powder

AA Sequence

QEPEFQRMSALRLAACKRKEQDQQKERALQPKKQRLVFTDLQRRTLIAIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NADSYN1 shRNA Plasmid
abx978978-01 150 µg

Mouse NADSYN1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse NADSYN1 shRNA Plasmid
abx978978-02 300 µg

Mouse NADSYN1 shRNA Plasmid

Sign In for Pricing
View Details
FF-10101 1mg
A20072-1 1 mg

FF-10101 1mg

Sign In for Pricing
View Details
Caspase 5 Rabbit monoclonal antibody
BS40251-01 50 µL

Caspase 5 Rabbit monoclonal antibody

Sign In for Pricing
View Details
Caspase 5 Rabbit monoclonal antibody
BS40251-02 100 µL

Caspase 5 Rabbit monoclonal antibody

Sign In for Pricing
View Details
JAKMIP2 Antibody
CSB-PA904679-01 50 μL

JAKMIP2 Antibody

Sign In for Pricing
View Details