Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Onecut3 Peptide - C-terminal region

Onecut3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OC-3, Oc3

UniProt

Q8K557

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Onecut3 Rabbit Polyclonal Antibody (orb576321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631972

Preservative

Lyophilized powder

AA Sequence

QEPEFQRMSALRLAACKRKEQDQQKERALQPKKQRLVFTDLQRRTLIAIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Ceacam1 Antibody Picoband®
A00923-3 100 µg/Vial

Anti-Ceacam1 Antibody Picoband®

Sign In for Pricing
View Details
Mouse Monoclonal V5 Epitope Tag Antibody (SV5-P-K) [DyLight 594]
NBP2-52703DL594 0.1 mL

Mouse Monoclonal V5 Epitope Tag Antibody (SV5-P-K) [DyLight 594]

Sign In for Pricing
View Details
Fibroblast Growth Factor 2, Basic (FGF2b) (BSA, Azide, Glycerol Free)
F4210-21X 500 µg

Fibroblast Growth Factor 2, Basic (FGF2b) (BSA, Azide, Glycerol Free)

Sign In for Pricing
View Details
CD45R Rat Monoclonal Antibody (FITC)
orb1293894-01 25 assay

CD45R Rat Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
CD45R Rat Monoclonal Antibody (FITC)
orb1293894-02 100 assay

CD45R Rat Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
Apolipoprotein F (APOF) Antibody
abx009587-01 30 µL

Apolipoprotein F (APOF) Antibody

Sign In for Pricing
View Details